PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g036480.1.1
Common NameLOC101257935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 327aa    MW: 37080.4 Da    PI: 6.6813
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g036480.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.4e-5551321128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL++k+++ ++++ ++i++vd++k+ePwdLp+k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+tgkdke
  Solyc12g036480.1.1   5 LPPGFRFHPTDEELITCYLNNKISDFNFTT-RAIADVDLNKSEPWDLPAKASMGEKEWYFFSLKDRKYPTGLRTNRATEAGYWKTTGKDKE 94 
                         79*************************999.89***************999999************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++  +g lvg+kktLvfy+grapkgekt+Wvmheyr+
  Solyc12g036480.1.1  95 IYRGgTGVLVGMKKTLVFYRGRAPKGEKTNWVMHEYRI 132
                         ***867778***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-633153IPR003441NAC domain
PROSITE profilePS5100559.7835153IPR003441NAC domain
PfamPF023652.2E-286132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDENLPPGFR FHPTDEELIT CYLNNKISDF NFTTRAIADV DLNKSEPWDL PAKASMGEKE  60
WYFFSLKDRK YPTGLRTNRA TEAGYWKTTG KDKEIYRGGT GVLVGMKKTL VFYRGRAPKG  120
EKTNWVMHEY RIETTFGYKP SKEEWVVCRV FQKSSTVKKP QPTSSSPLSL ESPCDTNYTI  180
TNELGDIELP FNFNYLTTTP STAINNISLH NYNNDNINLA AATREANSHP LLPWSSNLLS  240
SNLSSVNSLL FRALQLKSYS PREQATTTHD YAFMLPQENI ITTQFGNDFA VNNIGAPSSS  300
TVLDNSVQQQ QQQQQEQSYK LDSNIW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-55415916171NO APICAL MERISTEM PROTEIN
1ut4_B1e-55415916171NO APICAL MERISTEM PROTEIN
1ut7_A1e-55415916171NO APICAL MERISTEM PROTEIN
1ut7_B1e-55415916171NO APICAL MERISTEM PROTEIN
3swm_A2e-55415919174NAC domain-containing protein 19
3swm_B2e-55415919174NAC domain-containing protein 19
3swm_C2e-55415919174NAC domain-containing protein 19
3swm_D2e-55415919174NAC domain-containing protein 19
3swp_A2e-55415919174NAC domain-containing protein 19
3swp_B2e-55415919174NAC domain-containing protein 19
3swp_C2e-55415919174NAC domain-containing protein 19
3swp_D2e-55415919174NAC domain-containing protein 19
4dul_A1e-55415916171NAC domain-containing protein 19
4dul_B1e-55415916171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252235.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4DEA50.0K4DEA5_SOLLC; Uncharacterized protein
STRINGSolyc12g036480.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.15e-98NAC domain containing protein 58
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]